PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT32794
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family Nin-like
Protein Properties Length: 705aa    MW: 78631.8 Da    PI: 6.6445
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT32794genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK87.11.5e-27374424252
    RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
               ek++sl++l+k+F++++k+AAk+Lgvc+T+LKriCR++GI+RWP+Rkik++
  EMT32794 374 EKTVSLQELRKHFAGSLKEAAKNLGVCPTTLKRICRHHGIDRWPSRKIKKV 424
               689**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.688363444IPR003035RWP-RK domain
PfamPF020422.9E-25376424IPR003035RWP-RK domain
SuperFamilySSF542771.57E-22589681No hitNo description
Gene3DG3DSA:3.10.20.2403.2E-23594677No hitNo description
PROSITE profilePS5174522.391596678IPR000270PB1 domain
SMARTSM006662.4E-25596678IPR000270PB1 domain
CDDcd064072.12E-39597677No hitNo description
PfamPF005645.8E-17597677IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 705 aa     Download sequence    Send to blast
MPVFERRTGA CLGVVELVMT TQKINYNAEI DNICNALKEV DLRGSDVSSD PRAQVVDTSY  60
RPIVPEIAHV LKAVCETHKL PLAQTWIPCV CQAKRASRHS DEKYKYCVST VDEACYVRDA  120
AMTGFHQACS EHHLFRGEGV VGTALGTNEP CFCPDITAYS KVQYPLSHYA KLFGLRAAVA  180
IRLRSVKTGS MDLILEFFLP NNCINSEEQG NMLNSLSNTI QQASCTLRVV GVKELANDGS  240
PETSSPTPPE VCDKPAEILD ELHTSGINVP ARTTSVDASE EVSSWIASLV DVQNNGVQGE  300
TDCGLPFGFR KQEDEGFSVT AGWPTSPVLV PEDKSFFPGF KKHEEYEAKG SPFSSDRSLS  360
NSDKAIEKRR TKIEKTVSLQ ELRKHFAGSL KEAAKNLGVC PTTLKRICRH HGIDRWPSRK  420
IKKVGHSLKK LQMVIDSVHG AEGTVRLSSL YENFTKTTWS ERELQGDLSY PASEQKVQLE  480
PSVPDRQCES RFSPRTSGSN SLSPTYSQSS NSSLGCSSDP KPQQQQSSAP QLAVKQEFFM  540
EENQSSTQMK AASHDELQLF TEEKPVTLCR SQSHMLFSEH KPMENMSGMQ EAKPDSLKIK  600
AMYGEERCIF RLQPSWGFEK LKEEIAKRFG ISWEVYDLKY LDDESEWVLL TCDADLLECI  660
DVYKSSSAKT VRISVNPAVQ PTRSYSAIGK LVYRSYQTSV QNRKE
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010229248.10.0PREDICTED: protein NLP1-like
RefseqXP_010229249.10.0PREDICTED: protein NLP1-like
RefseqXP_014752172.10.0PREDICTED: protein NLP1-like
RefseqXP_014752173.10.0PREDICTED: protein NLP1-like
RefseqXP_014752174.10.0PREDICTED: protein NLP1-like
SwissprotQ10S830.0NLP1_ORYSJ; Protein NLP1
TrEMBLM8CEH60.0M8CEH6_AEGTA; Uncharacterized protein
STRINGMLOC_53458.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP110253241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.11e-159Nin-like family protein